PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017487
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 343aa    MW: 38007.6 Da    PI: 8.933
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-34639PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.46.8e-2587131145
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  Lsa017487  87 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVES 131
                79****************************************986 PP

2QLQ61.42.5e-212560237
        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
               +FT+ Q+q+L++Q+l+yKyL+a++PvP +L+++i++
  Lsa017487 25 PFTPVQWQELEHQALIYKYLVAGVPVPYDLVVPIRR 60
               9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-112460IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-152559IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.7372560IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.76287131IPR014977WRC domain
PfamPF088794.0E-2188130IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSGSTTVAVA GGGGGGGGIS GYRPPFTPVQ WQELEHQALI YKYLVAGVPV PYDLVVPIRR  60
SLEALSARFF TNPTSLSYCS YYGKKFDPEP GRCRRTDGKK WRCSKDAYPD SKYCERHMHR  120
GRNRSRKPVE SQSQSLSQSQ SQSQSASQPL STTAVSNVST VSNGGNRSYQ NLGNGSFQNS  180
SLYPTSSSCS FDFGSNVSKL QVHGSAYGIN NNSFRYDQSL TVDVDDQNYT SXYMASTPKP  240
NSHIFFNGIK NRTLTQTKSM VNFDSVVDPI SMSKPSQQQQ QQQQHCLFGS KIGSPIEVKN  300
EQQSMRPFFD EWPEAREPWS TTQLSMSTTN DYTARSDCTS NDG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605690.11e-111PREDICTED: growth-regulating factor 4-like isoform X2
RefseqXP_016481859.11e-111PREDICTED: growth-regulating factor 4-like isoform X2
TrEMBLA0A118JU761e-149A0A118JU76_CYNCS; Glutamine-Leucine-Glutamine, QLQ
STRINGSolyc08g075950.1.11e-109(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-48growth-regulating factor 5